ФЭНДОМ


Универсальные Белки Напряжения Править

Universal stress protein UspA

UspA в E. coli K 12 назвали универсальным белком напряжения в 1992 Nyström и Neidhardt, кто показал, что его синтез вызван в ответ на большое количество усилий (7). Единственное напряжение, которое не вызывает синтез UspA, является холодным шоком (8). Синтез UspA и по крайней мере четыре из пяти парарегистраций UspA вызваны, накладываясь, но неидентичные наборы усилий (2, 3, 4). Синтез UspA (uspA), UspC (yecG), UspD (yiiT), UspE (ydaA), и UspG (ybdQ) вызваны голоданием для глюкозы или фосфата и после входа в постоянную фазу в богатой среде. Все пять также вызваны обработкой с несцепным прибором dinitrophenol и шоком высокой температуры. Однако, белки UspA отличаются по их ответам на окислительное напряжение и ДНК разрушительные агенты


hypothetical protein HP0031


MNILFGISDTQECYNAIKFAVKLAHSLKEVRFTLLHVSMEVFIYSESGMMDYGQTEALEEEKAKALLKQFEDAFKKENIECESVLKSGDLIDVVLDMAKDYDLLLIGASESNLLYRLFISHQNSLVEQSSIPVVIAK


См. также Править

Обнаружено использование расширения AdBlock.


Викия — это свободный ресурс, который существует и развивается за счёт рекламы. Для блокирующих рекламу пользователей мы предоставляем модифицированную версию сайта.

Викия не будет доступна для последующих модификаций. Если вы желаете продолжать работать со страницей, то, пожалуйста, отключите расширение для блокировки рекламы.

Также на ФЭНДОМЕ

Случайная вики